Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0200400_circ_g.1 |
ID in PlantcircBase | osa_circ_000742 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 5436898-5439316 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0200400 |
Parent gene annotation |
Thioredoxin domain 2 containing protein. (Os01t0200400-01) |
Parent gene strand | - |
Alternative splicing | Os01g0200400_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0200400-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.101979344 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5438230-5436982(+) 5436934-5439285(-) 5437152-5438218(-) |
Potential amino acid sequence |
MTKTIIRWLLSNSIYNFVIFGTNTFDSFMISGNRATSVALSKSI*(+) MNQKYLCQKLQSYICCCSTATL*(-) MWDHLPTYILFDKATEVARFPEIMNESKVFVPKITKLYMLLLNSHLMMVLVIQII*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |