Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0810450_circ_g.1 |
ID in PlantcircBase | osa_circ_017107 |
Alias | Os_ciR4680 |
Organism | Oryza sativa |
Position | chr2: 34650670-34651677 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0810450 |
Parent gene annotation |
Similar to endoribonuclease. (Os02t0810450-01) |
Parent gene strand | + |
Alternative splicing | Os02g0810450_circ_g.2 |
Support reads | 4/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0810450-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.127687996 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34650680-34650719(+) 34651605-34650703(+) |
Potential amino acid sequence |
MGLKPSAHLGKELAELKCHLLQLNESYGINVCGEGGEYETLTLDCPLFRNARIVLDDFEVILHS PDSIAPVGILHPLKFHLEHKPNSFGTVGDSAIAQENSSYLYEVDGAIAHSDVEKKQETLSPVTT VDACTNIDLCISKTGKKLFSIGCWIQDPCGTSEGCRNGAQTFCSLRERTG*(+) MHLKDWQKVVLHWLLDSGSLWYFRRLPQWGSNLLLT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |