Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0232500_circ_g.8 |
| ID in PlantcircBase | osa_circ_013998 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 7507710-7507898 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0232500 |
| Parent gene annotation |
Similar to Receptor-like serine/threonine kinase. (Os02t0232500- 01);Similar to Receptor-like serine/threonine kinase. (Os02t0232 500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0232500-02:2 Os02t0232500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187980776 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7507859-7507709(+) 7507740-7507739(+) 7507861-7507864(-) 7507886-7507864(-) |
| Potential amino acid sequence |
MFTKESSLHGQTTLNMVSSFSSSNDNLLQPCLRKNLPCMDKPR*(+) MTIFCNHVYERIFPAWTNHAKYGFKFFILK*(+) MVAKDCHLRMKNLKPYLAWFVHAGKILS*(-) MQGRFFRKHGCKRLSFEDEKLETIFSVVCPCREDSFVNMVAKDCHLRMKNLKPYLAWFVHAGKI LS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |