Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0849600_circ_g.2 |
ID in PlantcircBase | osa_circ_022714 |
Alias | Os_ciR1139 |
Organism | Oryza sativa |
Position | chr3: 35736824-35737161 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circseq_cup, find_circ |
Parent gene | Os03g0849600 |
Parent gene annotation |
COG complex component, COG2 family protein. (Os03t0849600-01) |
Parent gene strand | - |
Alternative splicing | Os03g0849600_circ_g.3 Os03g0849600_circ_g.4 Os03g0849600_circ_g.5 Os03g0849600_circ_g.6 Os03g0849600_circ_g.7 Os03g0849600_circ_g.8 Os03g0849600_circ_g.9 |
Support reads | 25/2/4 |
Tissues | root/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0849600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.486062549 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35737064-35736826(-) |
Potential amino acid sequence |
MVSEVVTVARKTESSLQRLRQGAQRRVGANTDTSDNIISDTDKICMQLFLDIQVFLEGDRIHYL SEDDKAKLRRGSTDKITSIYYDMVSEVVTVARKTESSLQRLRQGAQRRVGANTDTSDNIISDTD KICMQLFLDIQVFLEGDRIHYLSEDDKAKLRRGSTDKITSIYYDMVSEVVTVARKTESSLQRLR QGAQRRVGANTDTSDNIISDTDKICMQLFLDIQVFLEGDRIHYLSEDDKAKLRRGSTDKITSIY YDMVSEVVTVARKTESSLQRLRQGAQRRVGANTDTSDNIISDTDKICMQLFLDIQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |