Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0743300_circ_g.4 |
ID in PlantcircBase | osa_circ_003841 |
Alias | Os_ciR6110 |
Organism | Oryza sativa |
Position | chr1: 31066931-31067410 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0743300 |
Parent gene annotation |
Protease-associated PA domain containing protein. (Os01t0743300- 01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0743300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010706 |
PMCS | 0.331965208 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31067295-31066945(+) 31067326-31066945(+) 31066964-31067376(-) |
Potential amino acid sequence |
MLTSRTVAYLNVDSAVYGAGFYASATPQLDELLKEASKQLYNPW*(+) MLILQCMVQGFMHQLLLNLMSCLRRRVNSYIILGNHRDAWTFGAVDPNSGTAALLELAQRFSEL QKKGWRPRRTIILCNWDAEEYGLVGSTEWVEENRAMLTSRTVAYLNVDSAVYGAGFYASATPQL DELLKEASKQLYNPW*(+) MHHDDYQGLYSCLLASLSNSSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |