Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d029772_circ_g.1 |
| ID in PlantcircBase | zma_circ_000674 |
| Alias | circ2564 |
| Organism | Zea mays |
| Position | chr1: 86352944-86353402 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplor2 |
| Parent gene | Zm00001d029772 |
| Parent gene annotation |
Ca2+/calmodulin-dependent protein kinase phosphatase |
| Parent gene strand | + |
| Alternative splicing | Zm00001d029772_circ_g.2 |
| Support reads | 6 |
| Tissues | seedling leaves |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-CA |
| Number of exons covered | Zm00001d029772_T002:2 Zm00001d029772_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.045569063 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
86352966-86352946(+) 86353327-86352965(+) 86353379-86353398(-) |
| Potential amino acid sequence |
MSGGVEPDTPPGSSSSSSRSGGSTPVGGKPPRHHLTSIRHCASSARIAAASAEFGLESGTLSLI SPTADIRPGFLPVFRSGSFADIGPKSFMEDEHVCVDNLVEHLGLRGPGIPAPGAFYGE*(+) MSVWTTSSSTLDSVARASLHRVPSMGSNGETEP*(+) MPGPRSPRCSTRLSTQTCSSSMKDLGPISAKLPDLNTGKKPGRMSAVGEIKLSVPDSSPNSAEA AAMRALLAQWRMDVRWWRGGLPPTGVLPPLLLLLLLLPGGVSGSTPPLMAPSLRYSP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2017b |