Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d004036_circ_g.4 |
ID in PlantcircBase | zma_circ_007210 |
Alias | Zm02circ00063, zma_circ_0000767 |
Organism | Zea mays |
Position | chr2: 77707239-77708054 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d004036 |
Parent gene annotation |
Protein XRI1 |
Parent gene strand | + |
Alternative splicing | Zm00001d004036_circ_g.1 Zm00001d004036_circ_g.2 Zm00001d004036_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d004036_T008:4 Zm00001d004036_T001:3 Zm00001d004036_T006:5 Zm00001d004036_T002:5 Zm00001d004036_T003:5 Zm00001d004036_T007:4 Zm00001d004036_T004:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.140992923 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
77707834-77707316(+) |
Potential amino acid sequence |
MKHPTSKKISFWNIALMERQCTLSQIKHLVASRALHVQMIKLVFQMLLNLCGIASIKMTMSCWD CLEIKPH*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b |