Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d004036_circ_g.4 |
| ID in PlantcircBase | zma_circ_007210 |
| Alias | Zm02circ00063, zma_circ_0000767 |
| Organism | Zea mays |
| Position | chr2: 77707239-77708054 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d004036 |
| Parent gene annotation |
Protein XRI1 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d004036_circ_g.1 Zm00001d004036_circ_g.2 Zm00001d004036_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d004036_T008:4 Zm00001d004036_T001:3 Zm00001d004036_T006:5 Zm00001d004036_T002:5 Zm00001d004036_T003:5 Zm00001d004036_T007:4 Zm00001d004036_T004:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.140992923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
77707834-77707316(+) |
| Potential amino acid sequence |
MKHPTSKKISFWNIALMERQCTLSQIKHLVASRALHVQMIKLVFQMLLNLCGIASIKMTMSCWD CLEIKPH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b |