Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d007529_circ_g.1 |
| ID in PlantcircBase | zma_circ_007423 |
| Alias | zma_circ_0000961 |
| Organism | Zea mays |
| Position | chr2: 233993051-233993727 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d007529 |
| Parent gene annotation |
Protein phosphatase 2C family protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d007529_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.12981012 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
233993648-233993056(+) 233993294-233993681(-) 233993059-233993476(-) |
| Potential amino acid sequence |
MDKLYLPMLEIQKLFCAPKDIICTIEIRT*(+) MVGLAMLVQIKYIVKNSNFPICQFPSRFSEPQRVYAIEKKINMEQEVIQKKLRSHLTSLSSIMT VKYCHHSHINLLNSHVLISMVQIISFGAQKSF*(-) MFLFRWCRLYPSEHRKAFESPTLADIICPSAIKTTVAVEPDSKLFCNASLENVKSIS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |