Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0767700_circ_g.2 |
| ID in PlantcircBase | osa_circ_004049 |
| Alias | Os01circ24173 |
| Organism | Oryza sativa |
| Position | chr1: 32352071-32352839 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder |
| Parent gene | Os01g0767700 |
| Parent gene annotation |
Similar to DEIH-box RNA/DNA helicase. (Os01t0767700-01);Similar to predicted protein. (Os01t0767700-02);Similar to predicted pro tein. (Os01t0767700-03) |
| Parent gene strand | + |
| Alternative splicing | Os01g0767700_circ_g.3 Os01g0767700_circ_g.4 Os01g0767700_circ_g.5 Os01g0767700_circ_g.6 Os01g0767700_circ_g.7 |
| Support reads | 3/3 |
| Tissues | leaf/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0767700-01:3 Os01t0767700-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002420* osi_circ_010758 |
| PMCS | 0.169807607 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32352125-32352142(+) 32352145-32352783(-) |
| Potential amino acid sequence |
MCRKMGMISKSSGNGERRCLSVYKRKQNQGLETEEGPSHLGFSVEARNVLQDLFMHYPPDDAEL NGHTVRNSSDKAVKIQWKPDGAFCRPALRKPDILKKVEMLASKVNKSEQLRKIVQDRSKLPISS YKDAISSTLENHQCTNLNLAYRNKSERRYMRCVEKWA*(+) MPIFLHISCIAARSCFDMPGSNLYTGDSLKSKKLHPCMRKLEV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |