Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0489400_circ_g.1 |
ID in PlantcircBase | osa_circ_014687 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 17036471-17037612 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0489400 |
Parent gene annotation |
Similar to 40S ribosomal protein S8. (Os02t0489400-01) |
Parent gene strand | + |
Alternative splicing | Os02g0489400_circ_g.2 Os02g0489400_circ_g.3 Os02g0489400_circ_g.4 Os02g0489400_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0489400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.398235559 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17036711-17036523(+) 17036654-17037491(-) |
Potential amino acid sequence |
MLPPSSSGTSLTMEWILVERRRLLQPRRMLRGRMLKLPQRKRRKATMLSGSLRSANRDAHLTPT SKNSLAVGGCWPAFLPALGSVAEQMGMSSEGSLPTPSCQATRQ*(+) MHCRPHQGYGSCGSRPHFPMSSCQYPNGGPSISHYLHGHAPSSLSCCLTAWCWQAAFRAHTHLL GHTAQGGKKCRPATSHCQTVLRCGRQVCVPVGASQAS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |