Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA003850_circ_g.3 |
ID in PlantcircBase | osi_circ_002168 |
Alias | 1:25218387|25219767 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 25218387-25219767 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA003850 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA003850_circ_g.1 BGIOSGA003850_circ_g.2 BGIOSGA003850_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA003850-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_002343* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25218439-25219710(-) 25218414-25219727(-) 25218511-25218403(+) |
Potential amino acid sequence |
MYCLFIKGDEVICSIELLLFVDHWVHSSEQMKQIQP*(-) MKSSAVLSSFYLLTIGCIPQNK*(-) MKARLSLEPILMLVAALSRDILEDFLPFLGRHANAILALLSDGGDRDPEIMEQVFTSWSYVMMY LQKYLVKDVVQVLRITAPLRFFPKDYVREFMAESVSFVLRNAPNGQQIEGAQYCR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |