Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0656100_circ_g.20 |
| ID in PlantcircBase | osa_circ_025737 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 33461937-33462041 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0656100 |
| Parent gene annotation |
H+-ATPase, Blue light-induced stomatal opening of dumbbell-shape d guard cells, N uptake (Os04t0656100-01);Similar to OSIGBa0158D 24.1 protein. (Os04t0656100-03);Similar to OSIGBa0158D24.1 prote in. (Os04t0656100-04) |
| Parent gene strand | + |
| Alternative splicing | Os04g0656100_circ_g.21 Os04g0656100_circ_g.22 Os04g0656100_circ_g.23 Os04g0656100_circ_g.24 Os04g0656100_circ_g.25 Os04g0656100_circ_g.26 Os04g0656100_circ_g.27 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0656100-01:1 Os04t0656100-03:1 Os04t0656100-04:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.324602302 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33461986-33461939(-) |
| Potential amino acid sequence |
MHLPLYILLAVAQGQDLSCNSKRTKPTLSILVNHSMHLPLYILLAVAQGQDLSCNSKRTKPTLS ILVNHSMHLPLYILLAVAQGQDLSCNSKRTKPTLSILVNHSMHLPLYILLAVAQGQD(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |