Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0500300_circ_g.3 |
| ID in PlantcircBase | osa_circ_037520 |
| Alias | Os08circ12414/Os_ciR2321 |
| Organism | Oryza sativa |
| Position | chr8: 24701761-24702374 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os08g0500300 |
| Parent gene annotation |
Protein phosphatase 2C domain containing protein. (Os08t0500300- 01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0500300_circ_g.2 Os08g0500300_circ_g.4 |
| Support reads | 2/5/2 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0500300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007836* osi_circ_018029 |
| PMCS | 0.541989848 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24702313-24701769(+) 24702127-24702369(-) |
| Potential amino acid sequence |
MTIWTMTIKHTTEDTITCIKVLEG*(+) MFLPLKQSYFKAFKLMDKELKMHPTVDCFCSGSTAVTLVKQGLDLVVGNLGDSRAIMGTRDAAN NLTAVQLTVDLKPNLPKL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |