Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0500300_circ_g.3 |
ID in PlantcircBase | osa_circ_037520 |
Alias | Os08circ12414/Os_ciR2321 |
Organism | Oryza sativa |
Position | chr8: 24701761-24702374 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os08g0500300 |
Parent gene annotation |
Protein phosphatase 2C domain containing protein. (Os08t0500300- 01) |
Parent gene strand | - |
Alternative splicing | Os08g0500300_circ_g.2 Os08g0500300_circ_g.4 |
Support reads | 2/5/2 |
Tissues | leaf/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0500300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007836* osi_circ_018029 |
PMCS | 0.541989848 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24702313-24701769(+) 24702127-24702369(-) |
Potential amino acid sequence |
MTIWTMTIKHTTEDTITCIKVLEG*(+) MFLPLKQSYFKAFKLMDKELKMHPTVDCFCSGSTAVTLVKQGLDLVVGNLGDSRAIMGTRDAAN NLTAVQLTVDLKPNLPKL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |