Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0124700_circ_g.1 |
| ID in PlantcircBase | osa_circ_012889 |
| Alias | Os_ciR7661 |
| Organism | Oryza sativa |
| Position | chr2: 1284082-1284369 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0124700 |
| Parent gene annotation |
Clathrin, heavy chain/VPS, 7-fold repeat domain containing prote in. (Os02t0124700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0124700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.312502778 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1284362-1284366(+) |
| Potential amino acid sequence |
MSELLCQYERRSVLKFLETFDSYRLERCLHLCLDYGVTDAAAFLQERVGDVGSALALILAGLDE KINLFISSVENAFSGIASKSISEIEQPDIVLKMSELLCQYERRSVLKFLETFDSYRLERCLHLC LDYGVTDAAAFLQERVGDVGSALALILAGLDEKINLFISSVENAFSGIASKSISEIEQPDIVLK MSELLCQYERRSVLKFLETFDSYRLERCLHLCLDYGVTDAAAFLQERVGDVGSALALILAGLDE KINLFISSVENAFSGIASKSISEIEQPDIVLKMSE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |