Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0124700_circ_g.1 |
ID in PlantcircBase | osa_circ_012889 |
Alias | Os_ciR7661 |
Organism | Oryza sativa |
Position | chr2: 1284082-1284369 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os02g0124700 |
Parent gene annotation |
Clathrin, heavy chain/VPS, 7-fold repeat domain containing prote in. (Os02t0124700-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0124700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.312502778 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1284362-1284366(+) |
Potential amino acid sequence |
MSELLCQYERRSVLKFLETFDSYRLERCLHLCLDYGVTDAAAFLQERVGDVGSALALILAGLDE KINLFISSVENAFSGIASKSISEIEQPDIVLKMSELLCQYERRSVLKFLETFDSYRLERCLHLC LDYGVTDAAAFLQERVGDVGSALALILAGLDEKINLFISSVENAFSGIASKSISEIEQPDIVLK MSELLCQYERRSVLKFLETFDSYRLERCLHLCLDYGVTDAAAFLQERVGDVGSALALILAGLDE KINLFISSVENAFSGIASKSISEIEQPDIVLKMSE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |