Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G018900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000230 |
| Alias | Chr03:1440033|1440161 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 1440033-1440161 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G018900 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/4 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.003G018900.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000082* |
| PMCS | 0.827656848 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1440094-1440158(+) |
| Potential amino acid sequence |
MQSNNPNLFCTSPSAQETILILRGFGYYSLRRQSLKLETRSKHMQSNNPNLFCTSPSAQETILI LRGFGYYSLRRQSLKLETRSKHMQSNNPNLFCTSPSAQETILILRGFGYYSLRRQSLKLETRSK HMQSNNPNLFCTSPSAQETILIL(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |