Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0692600_circ_g.2 |
ID in PlantcircBase | osa_circ_003449 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 28581586-28582377 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0692600 |
Parent gene annotation |
Uncharacterised conserved protein UCP031088, alpha/beta hydrolas e, At1g15070 domain containing protein. (Os01t0692600-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0692500-00:2 Os01t0692500-00:2 Os01t0692600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.14320846 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28582347-28581631(+) 28581629-28582290(-) |
Potential amino acid sequence |
MRIMTWLEGERHGASKGFTTADNCIP*(+) MQLSAVVKPLLAPCLSPSNQVIMRIMRAFGLSKNLICHQMLRN*(-) |
Sponge-miRNAs | osa-miR1435 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |