Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0545600_circ_g.3 |
| ID in PlantcircBase | osa_circ_009554 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 20101713-20105994 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0545600 |
| Parent gene annotation |
Reader protein of trimethylated histone H3 lysine 4 (H3K4me3) an d histone H3 lysine 36 (H3K36me3), Brassinosteroid-regulated gro wth, Flowering time control (Os11t0545600-01);Similar to H0102C0 9.3 protein. (Os11t0545600-02);MRG family protein. (Os11t0545600 -03) |
| Parent gene strand | - |
| Alternative splicing | Os11g0545600_circ_g.1 Os11g0545600_circ_g.2 Os11g0545600_circ_g.4 Os11g0545600_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0545600-01:7 Os11t0545600-03:3 Os11t0545600-02:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.097423535 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20105948-20103462(+) 20102540-20104765(-) |
| Potential amino acid sequence |
MDMIPPLILLVFGLLNLLSFFVRCSKYFFRISSTVGDRGSFTSLPSCVTNSQSSTSCFFSVEGK CDMKRLSDDFLSFSSVPPG*(+) MSHFPSTLKKQLVDDWEFVTQLGKLVKLPRSPTVDDILKKYLEHRTKKDNKFKSPKTRRMSGGI MSIILVGIRAGMNGSQMIAY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |