Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0724000_circ_g.2 |
ID in PlantcircBase | osa_circ_016358 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 30097390-30098165 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0724000 |
Parent gene annotation |
CONSTANS-like protein, Heading promotion under long-day conditio n (Os02t0724000-01) |
Parent gene strand | + |
Alternative splicing | Os02g0724000_circ_g.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0724000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.170692848 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30097415-30097465(+) 30098127-30097421(+) |
Potential amino acid sequence |
MFNDGSVYGDFCVDDADLTFENYEELFGTSHVQTEQLFDDAGIDSYFEMKDVPADESNEQPKPV QPECSNVASVDSGMSNPAARADSSHCIPGRQAISNISLSFSGLTGESSAGYFQDCGVSSMILMG EPPWHPPGPESSSAGGSRDNALTRYKEKKKRRKHPVSQTKICSMMGAYMETSVWMMLT*(+) MLLHGTRRRRREESTLCHRQRYVQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |