Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0724000_circ_g.2 |
| ID in PlantcircBase | osa_circ_016358 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 30097390-30098165 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0724000 |
| Parent gene annotation |
CONSTANS-like protein, Heading promotion under long-day conditio n (Os02t0724000-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0724000_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0724000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.170692848 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30097415-30097465(+) 30098127-30097421(+) |
| Potential amino acid sequence |
MFNDGSVYGDFCVDDADLTFENYEELFGTSHVQTEQLFDDAGIDSYFEMKDVPADESNEQPKPV QPECSNVASVDSGMSNPAARADSSHCIPGRQAISNISLSFSGLTGESSAGYFQDCGVSSMILMG EPPWHPPGPESSSAGGSRDNALTRYKEKKKRRKHPVSQTKICSMMGAYMETSVWMMLT*(+) MLLHGTRRRRREESTLCHRQRYVQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |