Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d011979_circ_g.1 |
| ID in PlantcircBase | zma_circ_009780 |
| Alias | Zm08circ00074 |
| Organism | Zea mays |
| Position | chr8: 165571805-165573077 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d011979 |
| Parent gene annotation |
DEK domain-containing chromatin associated protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d011979_T001:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112418932 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
165573073-165572119(+) |
| Potential amino acid sequence |
MKLLCRSTFRSYLTTYFRFPSAFLPLLFISENNIPGNTRRL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |