Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d011979_circ_g.1 |
ID in PlantcircBase | zma_circ_009780 |
Alias | Zm08circ00074 |
Organism | Zea mays |
Position | chr8: 165571805-165573077 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d011979 |
Parent gene annotation |
DEK domain-containing chromatin associated protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d011979_T001:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.112418932 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
165573073-165572119(+) |
Potential amino acid sequence |
MKLLCRSTFRSYLTTYFRFPSAFLPLLFISENNIPGNTRRL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |