Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0796500_circ_g.1 |
| ID in PlantcircBase | osa_circ_016937 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 33862235-33863440 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0796500 |
| Parent gene annotation |
B-type response regulator, Cytokinin signaling (Os02t0796500-01) ;B-type response regulator, Cytokinin signaling (Os02t0796500-02 );B-type response regulator, Cytokinin signaling (Os02t0796500-0 3) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-GC |
| Number of exons covered | Os02t0796500-03:3 Os02t0796500-02:3 Os02t0796500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.189764352 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33862280-33863379(-) |
| Potential amino acid sequence |
MLRNSQGKMLQVTYSDDNKSGCYRAENAAGKQGHV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |