Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0796500_circ_g.1 |
ID in PlantcircBase | osa_circ_016937 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 33862235-33863440 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0796500 |
Parent gene annotation |
B-type response regulator, Cytokinin signaling (Os02t0796500-01) ;B-type response regulator, Cytokinin signaling (Os02t0796500-02 );B-type response regulator, Cytokinin signaling (Os02t0796500-0 3) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-GC |
Number of exons covered | Os02t0796500-03:3 Os02t0796500-02:3 Os02t0796500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.189764352 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33862280-33863379(-) |
Potential amino acid sequence |
MLRNSQGKMLQVTYSDDNKSGCYRAENAAGKQGHV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |