Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0447300_circ_g.7 |
| ID in PlantcircBase | osa_circ_037240 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 21845266-21846376 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0447300 |
| Parent gene annotation |
Similar to serine esterase family protein. (Os08t0447300-00) |
| Parent gene strand | - |
| Alternative splicing | Os08g0447300_circ_g.1 Os08g0447300_circ_g.2 Os08g0447300_circ_g.3 Os08g0447300_circ_g.4 Os08g0447300_circ_g.5 Os08g0447300_circ_g.6 Os08g0447300_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0447300-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104635644 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21846335-21846370(-) 21845272-21846370(-) |
| Potential amino acid sequence |
MPEKVIVHRSQCNSATQTFDGVDLMGERLANERG*(-) MSADDWKFAAEQFVRRMPEKVIVHRSQCNSATQTFDGVDLMGERLANERG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |