Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0541700_circ_g.2 |
| ID in PlantcircBase | osa_circ_014945 |
| Alias | Os_ciR7795 |
| Organism | Oryza sativa |
| Position | chr2: 20126011-20127528 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0541700 |
| Parent gene annotation |
Similar to Ubiquinol-cytochrome c reductase complex 7.8 kDa prot ein (EC 1.10.2.2) (Mitochondrial hinge protein) (CR7). (Os02t054 1700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0541700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.205550747 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20127466-20126039(+) 20126023-20126089(-) 20127468-20126060(-) |
| Potential amino acid sequence |
MLATAAGEATRPPRRRKIRIPTDIHTTGTHT*(+) MNISWNPDLPSSRGSRRLAGGRREHVG*(-) MSDEEVSDPKALLEDRSKAKCVYQWYEYQLESGSSFVEGVASPRRRPSRACRMRRYLTRRHS*( -) |
| Sponge-miRNAs | osa-miR1848 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |