Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G215300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000959 |
| Alias | Chr09:16731254|16732439 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 16731254-16732439 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G215300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/30 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.009G215300.2:4 Gorai.009G215300.1:4 Gorai.009G215300.3:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000104* |
| PMCS | 0.111042327 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16732283-16731264(+) 16732290-16731264(+) |
| Potential amino acid sequence |
MLNECCWLACESIYQPPGKSTSNGYCAVAPTILAGQIDPILFEALYASQHAIFFFARVPQIWKN FSNKSTGELSFLTCLMNVAGSLVRVFTSLQEKAPAMDIVL*(+) MNVAGSLVRVFTSLQEKAPAMDIVL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |