Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0321900_circ_g.2 |
ID in PlantcircBase | osa_circ_019559 |
Alias | Os_ciR8467 |
Organism | Oryza sativa |
Position | chr3: 11654882-11655619 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0321900 |
Parent gene annotation |
Similar to tRNA-specific adenosine deaminase. (Os03t0321900-01); CMP/dCMP deaminase, zinc-binding domain containing protein. (Os0 3t0321900-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0321900-02:3 Os03t0321900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012937 |
PMCS | 0.162663866 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11655187-11654895(+) 11655618-11655154(+) 11654942-11655221(-) 11655189-11655589(-) |
Potential amino acid sequence |
MSLHQSSSAELSGEEIPGPKGYKCTGGIMAEEAVALFRNFYEQGNPNGYKAC*(+) MATRHAEMEAIDILLREWQGMGLDQPQVAEKFARCDLYVTCEPCIMNKGGVLWLC*(+) MPCHSLSRISIASISACLVAIWIPLLVEISKKSHCLLRHDPTSTFVTFWPGNFLP*(-) MIDPHPPNLSLAQPKYTSLIHYARLTCDIKVASCKLLRDLWLIKSHALPLPKQDINCFHLSMPC SHLDSLARRNF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |