Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0321900_circ_g.2 |
| ID in PlantcircBase | osa_circ_019559 |
| Alias | Os_ciR8467 |
| Organism | Oryza sativa |
| Position | chr3: 11654882-11655619 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0321900 |
| Parent gene annotation |
Similar to tRNA-specific adenosine deaminase. (Os03t0321900-01); CMP/dCMP deaminase, zinc-binding domain containing protein. (Os0 3t0321900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0321900-02:3 Os03t0321900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012937 |
| PMCS | 0.162663866 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11655187-11654895(+) 11655618-11655154(+) 11654942-11655221(-) 11655189-11655589(-) |
| Potential amino acid sequence |
MSLHQSSSAELSGEEIPGPKGYKCTGGIMAEEAVALFRNFYEQGNPNGYKAC*(+) MATRHAEMEAIDILLREWQGMGLDQPQVAEKFARCDLYVTCEPCIMNKGGVLWLC*(+) MPCHSLSRISIASISACLVAIWIPLLVEISKKSHCLLRHDPTSTFVTFWPGNFLP*(-) MIDPHPPNLSLAQPKYTSLIHYARLTCDIKVASCKLLRDLWLIKSHALPLPKQDINCFHLSMPC SHLDSLARRNF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |