Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0249300_circ_g.1 |
ID in PlantcircBase | osa_circ_001036 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 8213383-8213694 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0249300 |
Parent gene annotation |
Lg106-like family protein. (Os01t0249300-01);Lg106-like family p rotein. (Os01t0249300-02) |
Parent gene strand | - |
Alternative splicing | Os01g0249300_circ_g.2 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0249300-02:2 Os01t0249300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.125680288 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8213606-8213412(+) 8213692-8213655(-) |
Potential amino acid sequence |
MELSSVWSIGSGFPTVSGPAALVSFISDMMLRDEWWFFWH*(+) MSDMKDTNAAGPETVGNPDPMDQTEDNSMPSAQEQELAIKKKFGGLMPKKPPLISKHHVGYEGH QCCWT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |