Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0249300_circ_g.1 |
| ID in PlantcircBase | osa_circ_001036 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 8213383-8213694 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0249300 |
| Parent gene annotation |
Lg106-like family protein. (Os01t0249300-01);Lg106-like family p rotein. (Os01t0249300-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0249300_circ_g.2 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0249300-02:2 Os01t0249300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.125680288 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8213606-8213412(+) 8213692-8213655(-) |
| Potential amino acid sequence |
MELSSVWSIGSGFPTVSGPAALVSFISDMMLRDEWWFFWH*(+) MSDMKDTNAAGPETVGNPDPMDQTEDNSMPSAQEQELAIKKKFGGLMPKKPPLISKHHVGYEGH QCCWT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |