Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0543600_circ_g.4 |
| ID in PlantcircBase | osa_circ_037917 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 27215325-27215423 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0543600 |
| Parent gene annotation |
Alpha-isopropylmalate/homocitrate synthase, conserved site domai n containing protein. (Os08t0543600-01);Hypothetical conserved g ene. (Os08t0543600-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0543600_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0543600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.228957071 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27215332-27215420(+) 27215383-27215327(-) |
| Potential amino acid sequence |
MVNLQSIQFPVLVIQFHFELKDVLFPFMQLFRLMVNLQSIQFPVLVIQFHFELKDVLFPFMQLF RLMVNLQSIQFPVLVIQFHFELKDVLFPFMQLFRLMVNLQSIQFPVLVIQFHFELKDVLFPFMQ LF(+) MKLDDKDRELDALKIDHQTEQLHEREKYILELEMKLDDKDRELDALKIDHQTEQLHEREKYILE LEMKLDDKDRELDALKIDHQTEQLHEREKYILELEMKLDDKDRELDALKIDHQT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |