Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0118000_circ_g.1 |
| ID in PlantcircBase | osa_circ_035660 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 1009088-1009835 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0118000 |
| Parent gene annotation |
Protein of unknown function DUF296 domain containing protein. (O s08t0118000-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0118000_circ_g.2 Os08g0118000_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0118000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.184729445 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1009094-1009707(+) |
| Potential amino acid sequence |
MVACSAGANFTPHIITVAPGEDVTMKVISFSQQGPRAICILSANGVISNVTLRQPDSSGGTLTY EVKWWLVLLVRILLLTSSLLLLERM*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |