Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G33210_circ_g.5 |
| ID in PlantcircBase | ath_circ_016234 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14076440-14076508 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT2G33210 |
| Parent gene annotation |
Chaperonin CPN60-like 1, mitochondrial |
| Parent gene strand | - |
| Alternative splicing | AT2G33210_circ_g.1 AT2G33210_circ_g.2 AT2G33210_circ_g.3 AT2G33210_circ_g.4 AT2G33210_circ_g.6 AT2G33210_circ_g.7 AT2G33210_circ_g.8 AT2G33210_circ_g.9 AT2G33210_circ_g.10 AT2G33210_circ_g.11 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G33210.2:1 AT2G33210.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.184779592 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14076488-14076442(-) 14076471-14076505(+) |
| Potential amino acid sequence |
MNLDNIDLSMFGNCKKVITEELGMNLDNIDLSMFGNCKKVITEELGMNLDNIDLSMFGNCKKVI TEELGMNLDNIDLSMFGNCKK(-) MLSRFIPNSSVITFLQFPNILRSMLSRFIPNSSVITFLQFPNILRSMLSRFIPNSSVITFLQFP NILRSMLSRFIPNSSVI(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |