Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0378100_circ_g.1 |
ID in PlantcircBase | osa_circ_006674 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 12093313-12093419 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os10g0378100 |
Parent gene annotation |
Similar to Cytochrome P450 family protein, expressed. (Os10t0378 100-01) |
Parent gene strand | - |
Alternative splicing | Os10g0378000_circ_ag.1 Os10g0378100_circ_g.2 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0378100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.333195372 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12093316-12093322(-) 12093321-12093338(-) |
Potential amino acid sequence |
MVYNPKRVESYCVDPITTCRPSILRQSVKFQPG*(-) MGWYTIPKGWKVIVWIRSLHVDPAYYDNPLSFNPDRWDGIQSQKGGKLLCGSDHYMSTQHTTTI R*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |