Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0700600_circ_g.9 |
| ID in PlantcircBase | osa_circ_016112 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 28824356-28824702 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0700600 |
| Parent gene annotation |
Similar to GAMYB-binding protein. (Os02t0700600-01);Similar to C yclin-dependent kinase F-4. (Os02t0700600-02);Similar to cDNA cl one:J013158B11, full insert sequence. (Os02t0700600-03);Similar to Cyclin-dependent kinase F-4. (Os02t0700600-04);Non-protein co ding transcript. (Os02t0700600-05) |
| Parent gene strand | + |
| Alternative splicing | Os02g0700600_circ_g.2 Os02g0700600_circ_g.3 Os02g0700600_circ_g.4 Os02g0700600_circ_g.5 Os02g0700600_circ_g.6 Os02g0700600_circ_g.7 Os02g0700600_circ_g.8 Os02g0700600_circ_g.10 Os02g0700600_circ_g.11 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0700600-04:2 Os02t0700600-03:2 Os02t0700600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.178939361 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28824652-28824376(+) 28824359-28824376(+) 28824379-28824628(-) |
| Potential amino acid sequence |
MATRIVSCRDHEVSVPSDMWAMGAIMAELLTLHPLFPGTSEADEILKICNVIGSPDEQSWPQGL SLAETMKFQFPQICGLWVP*(+) MWAMGAIMAELLTLHPLFPGTSEADEILKICNVIGSPDEQSWPQGLSLAETMKFQFPQICGLWV P*(+) MAPIAHISEGTETSWSLQETILVAMIVHLGYR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |