Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0205300_circ_g.3 |
| ID in PlantcircBase | osa_circ_013738 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 5920303-5922135 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0205300 |
| Parent gene annotation |
Similar to TAT-binding protein homolog (Fragment). (Os02t0205300 -01);Similar to TAT-binding protein homolog (Fragment). (Os02t02 05300-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0205300_circ_g.2 Os02g0205300_circ_g.4 Os02g0205300_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0205300-02:6 Os02t0205300-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_039380 |
| PMCS | 0.25595231 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5922132-5922072(-) |
| Potential amino acid sequence |
MLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSY MLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKG VLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMD EIDSIGSARMESGTGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRID RKIEFPNPNEDLECSGKSCSCFKNLARMLVRW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |