Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0205300_circ_g.3 |
ID in PlantcircBase | osa_circ_013738 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 5920303-5922135 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0205300 |
Parent gene annotation |
Similar to TAT-binding protein homolog (Fragment). (Os02t0205300 -01);Similar to TAT-binding protein homolog (Fragment). (Os02t02 05300-02) |
Parent gene strand | - |
Alternative splicing | Os02g0205300_circ_g.2 Os02g0205300_circ_g.4 Os02g0205300_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0205300-02:6 Os02t0205300-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | ath_circ_039380 |
PMCS | 0.25595231 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5922132-5922072(-) |
Potential amino acid sequence |
MLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSY MLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKG VLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMD EIDSIGSARMESGTGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRID RKIEFPNPNEDLECSGKSCSCFKNLARMLVRW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |