Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d052921_circ_g.1 |
ID in PlantcircBase | zma_circ_008231 |
Alias | zma_circ_0001668 |
Organism | Zea mays |
Position | chr4: 204935532-204936523 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d052921 |
Parent gene annotation |
THUMP domain-containing protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d052921_T006:2 Zm00001d052921_T004:2 Zm00001d052921_T002:2 Zm00001d052921_T005:2 Zm00001d052921_T003:2 Zm00001d052921_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130375781 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
204936429-204935555(+) |
Potential amino acid sequence |
MKIINAAAKSVPQPHKVDLKNPDKTIVVQIAKIYSASFAC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |