Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d052921_circ_g.1 |
| ID in PlantcircBase | zma_circ_008231 |
| Alias | zma_circ_0001668 |
| Organism | Zea mays |
| Position | chr4: 204935532-204936523 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d052921 |
| Parent gene annotation |
THUMP domain-containing protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d052921_T006:2 Zm00001d052921_T004:2 Zm00001d052921_T002:2 Zm00001d052921_T005:2 Zm00001d052921_T003:2 Zm00001d052921_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.130375781 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
204936429-204935555(+) |
| Potential amino acid sequence |
MKIINAAAKSVPQPHKVDLKNPDKTIVVQIAKIYSASFAC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |