Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0574550_circ_g.5 |
| ID in PlantcircBase | osa_circ_029059 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 28623787-28624550 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0574500 |
| Parent gene annotation |
Similar to GTP-binding nuclear protein Ran1B (Fragment). (Os05t0 574500-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0574550_circ_g.1 Os05g0574550_circ_g.2 Os05g0574550_circ_g.3 Os05g0574550_circ_g.4 Os05g0574550_circ_g.6 |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0574550-00:2 Os05t0574500-01:2 Os05t0574550-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.130999476 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28623819-28623813(+) 28623794-28623842(-) |
| Potential amino acid sequence |
MPLHKCSFTSPAIADDDQLEAGVIHGPLIRQRAHISFQTLQ*(+) MSALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYERAAESGDRGLPQLQAGHRRR WRDW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |