Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0215400_circ_g.3 |
| ID in PlantcircBase | osa_circ_018532 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 6054054-6055559 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0215400 |
| Parent gene annotation |
MADS-domain-containing protein, Sexual reproduction (Os03t021540 0-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0215400_circ_g.2 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0215400-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.100599685 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6055558-6054440(+) 6055560-6054714(-) |
| Potential amino acid sequence |
MLFPQVFVEILQLLLLALQIKQLIKQCLVLS*(+) MYKTLERYRSCNYNSQDAAAPENEINYQEYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLE NQIEVSLKQIRSRKNQALLDQLFDLKSKEQQLQDLNKDLRKKHVQNLGEVPQLQLQLTGCSSSR KRN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |