Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0170000_circ_g.1 |
ID in PlantcircBase | osa_circ_013375 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 3799107-3799252 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0170000 |
Parent gene annotation |
Conserved hypothetical protein. (Os02t0170000-01);Pentatricopept ide repeat domain containing protein. (Os02t0170000-02) |
Parent gene strand | + |
Alternative splicing | Os02g0169700_circ_ag.1 Os02g0169700_circ_ag.2 Os02g0169900_circ_g.1 Os02g0169900_circ_g.2 Os02g0169900_circ_g.3 Os02g0170000_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0170000-02:1 Os02t0170000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.198652968 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3799188-3799142(+) |
Potential amino acid sequence |
MKRERCRANTETFTLMINVYGKMLLYIMLTWMDY*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |