Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0700700_circ_g.8 |
| ID in PlantcircBase | osa_circ_032204 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 29480296-29480539 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0700700 |
| Parent gene annotation |
Similar to P1B-type heavy metal transporting ATPase. (Os06t07007 00-01);P-Type heavy metal ATPase, Delivery of Zinc to developing tissues (Os06t0700700-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0700700-01:1 Os06t0700700-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.243509392 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29480487-29480534(-) |
| Potential amino acid sequence |
MAAEGGRCQKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIVPSRTVIVVHDVDAISQSQIG L*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |