Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0307600_circ_g.1 |
ID in PlantcircBase | osa_circ_019469 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 10951260-10951418 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0307600 |
Parent gene annotation |
Hypothetical protein. (Os03t0307600-00) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0307700-00:1 Os03t0307700-00:1 Os03t0307600-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.307129455 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10951339-10951280(+) |
Potential amino acid sequence |
MGIMGRPLHQSKENSSVLPKLIPVAFQSELLSRR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |