Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0233400_circ_g.2 |
| ID in PlantcircBase | osa_circ_030311 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 6929234-6929505 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0233400 |
| Parent gene annotation |
Defective in cullin neddylation domain containing protein. (Os06 t0233400-01);Defective in cullin neddylation domain containing p rotein. (Os06t0233400-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0233400_circ_g.1 Os06g0233400_circ_g.3 Os06g0233400_circ_g.4 Os06g0233400_circ_g.5 Os06g0233400_circ_g.6 Os06g0233400_circ_g.7 |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0233400-02:2 Os06t0233400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.188142065 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6929423-6929406(+) 6929471-6929236(-) 6929263-6929449(-) |
| Potential amino acid sequence |
MVDKGPVPFSKEQLPHSKSSLQCERFLTLDKFQQLRPCVPRNGFIMPHL*(+) MWQLLFAERHWPLIDHWCQFLQVRHNKAISRDTWSQLLEFVKGQKSLALETALGMWQLLFAERH WPLIDHWCQFLQVRHNKAISRDTWSQLLEFVKGQKSLALETALGMWQLLFAERHWPLIDHWCQF LQVRHNKAISRDTWSQLLEFVKGQKSLALETALGMWQLLFAERHWPLIDHWCQFLQVRHNKAIS RDTWSQLLEFVK(-) MVSTVGICQGSKISRTGDCSWNVAVALC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |