Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G43370_circ_g.2 |
ID in PlantcircBase | ath_circ_018137 |
Alias | At_ciR3562 |
Organism | Arabidpsis thaliana |
Position | chr2: 18014345-18014785 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT2G43370 |
Parent gene annotation |
U11/U12 small nuclear ribonucleoprotein 35 kDa protein |
Parent gene strand | + |
Alternative splicing | AT2G43370_circ_g.1 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G43370.1:3 AT2G43370.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.173665343 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18014408-18014782(+) |
Potential amino acid sequence |
MPGWIPRRLGGGLGGRKESGQLRFGGRDRPFRAPLRPIPHEDLKKLGIQLPPEGRYMSRTQDAH HSLIDGREIIVDYNRQQLMPGWIPRRLGGGLGGRKESGQLRFGGRDRPFRAPLRPIPHEDLKKL GIQLPPEGRYMSRTQDAHHSLIDGREIIVDYNRQQLMPGWIPRRLGGGLGGRKESGQLRFGGRD RPFRAPLRPIPHEDLKKLGIQLPPEGRYMSRTQDAHHSLIDGREIIVDYNRQQLMPGWIPRRLG GGLGGRKESGQLRFGGRDRPFRAPLRPIPHEDLKKLGIQLPPEGRYMSRTQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |