Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0507800_circ_g.2 |
| ID in PlantcircBase | osa_circ_007603 |
| Alias | Os10circ07326 |
| Organism | Oryza sativa |
| Position | chr10: 19437053-19437167 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os10g0507800 |
| Parent gene annotation |
Similar to chaperone protein dnaJ 13. (Os10t0507800-01);Similar to Chaperone protein dnaJ 13. (Os10t0507800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0507800-01:1 Os10t0507800-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216662681 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19437140-19437164(+) 19437116-19437071(-) |
| Potential amino acid sequence |
MLLSNVVKFEFPTILSDSWRVQAFDRLIDPSLKERASPDVAVECGEI*(+) MDLSIYQMPGLANYLTILLGIQISPHSTATSGLALSLRDGSINLSNAWTRQLSDNIVGNSNFTT FDSNIWTCSFFERWIYQSIKCLDSPTI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |