Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d025816_circ_g.1 |
| ID in PlantcircBase | zma_circ_010326 |
| Alias | zma_circ_0000060 |
| Organism | Zea mays |
| Position | chr10: 130437350-130437667 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d025816 |
| Parent gene annotation |
DNA mismatch repair protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d025816_T011:2 Zm00001d025816_T006:2 Zm00001d025816_T007:2 Zm00001d025816_T008:2 Zm00001d025816_T015:2 Zm00001d025816_T005:2 Zm00001d025816_T009:2 Zm00001d025816_T014:2 Zm00001d025816_T002:2 Zm00001d025816_T017:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141509224 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
130437417-130437403(+) |
| Potential amino acid sequence |
MDDGFLHLSIFSFHHMICDSILSSQYSPCLLAFLDATEMPRETFLGLDQALRSNILPFLKFGSN PNIFEYTSL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |