Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d025816_circ_g.1 |
ID in PlantcircBase | zma_circ_010326 |
Alias | zma_circ_0000060 |
Organism | Zea mays |
Position | chr10: 130437350-130437667 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d025816 |
Parent gene annotation |
DNA mismatch repair protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d025816_T011:2 Zm00001d025816_T006:2 Zm00001d025816_T007:2 Zm00001d025816_T008:2 Zm00001d025816_T015:2 Zm00001d025816_T005:2 Zm00001d025816_T009:2 Zm00001d025816_T014:2 Zm00001d025816_T002:2 Zm00001d025816_T017:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.141509224 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
130437417-130437403(+) |
Potential amino acid sequence |
MDDGFLHLSIFSFHHMICDSILSSQYSPCLLAFLDATEMPRETFLGLDQALRSNILPFLKFGSN PNIFEYTSL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |