Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0240500_circ_g.3 |
ID in PlantcircBase | osa_circ_038514 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 3083592-3085519 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0240500 |
Parent gene annotation |
Similar to Sulfate transporter 4.1, chloroplast precursor (AST82 ). (Os09t0240500-01);Similar to Sulfate transporter 4.1. (Os09t0 240500-02);Similar to Sulfate transporter 4.1. (Os09t0240500-03) ;Similar to Sulfate transporter 4.1. (Os09t0240500-04) |
Parent gene strand | + |
Alternative splicing | Os09g0240500_circ_g.1 Os09g0240500_circ_g.2 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0240500-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018805 |
PMCS | 0.114079655 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3083846-3083789(+) 3085497-3083789(+) |
Potential amino acid sequence |
MGIIIGGALLFMTPLFTDIPQCALAAIVISAVTSLVDYEEAIFLWSIDKKDFFLWAITFITTLI FGIEIGVLVGVGFSLAFVIHESANPHIVIWAWYSKHMRFIFLFISCYRFLF*(+) MSQQILISLFGLGIANICGSFFSSYPATGSFSRSAVNHESGAKTGLSGIIMGIIIGGALLFMTP LFTDIPQCALAAIVISAVTSLVDYEEAIFLWSIDKKDFFLWAITFITTLIFGIEIGVLVGVGFS LAFVIHESANPHIVIWAWYSKHMRFIFLFISCYRFLF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |