Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0240500_circ_g.3 |
| ID in PlantcircBase | osa_circ_038514 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 3083592-3085519 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0240500 |
| Parent gene annotation |
Similar to Sulfate transporter 4.1, chloroplast precursor (AST82 ). (Os09t0240500-01);Similar to Sulfate transporter 4.1. (Os09t0 240500-02);Similar to Sulfate transporter 4.1. (Os09t0240500-03) ;Similar to Sulfate transporter 4.1. (Os09t0240500-04) |
| Parent gene strand | + |
| Alternative splicing | Os09g0240500_circ_g.1 Os09g0240500_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0240500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018805 |
| PMCS | 0.114079655 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3083846-3083789(+) 3085497-3083789(+) |
| Potential amino acid sequence |
MGIIIGGALLFMTPLFTDIPQCALAAIVISAVTSLVDYEEAIFLWSIDKKDFFLWAITFITTLI FGIEIGVLVGVGFSLAFVIHESANPHIVIWAWYSKHMRFIFLFISCYRFLF*(+) MSQQILISLFGLGIANICGSFFSSYPATGSFSRSAVNHESGAKTGLSGIIMGIIIGGALLFMTP LFTDIPQCALAAIVISAVTSLVDYEEAIFLWSIDKKDFFLWAITFITTLIFGIEIGVLVGVGFS LAFVIHESANPHIVIWAWYSKHMRFIFLFISCYRFLF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |