Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0552300_circ_g.1 |
| ID in PlantcircBase | osa_circ_002167 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 20739638-20740017 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0552300 |
| Parent gene annotation |
Similar to Protein phosphatase-2C. (Os01t0552300-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0552300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.401055624 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20740015-20739937(+) 20739649-20739661(+) 20739726-20739915(-) |
| Potential amino acid sequence |
MGSSRWTRKMSPAPRPRPCSSGTMSLLSRTLATPACRSYHAVGGLKL*(+) MDKEDESGATATAMFLRNDVLVVSHIGDSCLQVVSRGGRPQAVTNFHRPYGNKKASLEEVKRIR AAGGWARADGQGR*(+) MCETTRTSFLRNMAVAVAPDSSSLSICSSPSTCCSDPLHLFKRRFLVPVRSVEVGHSLRPPTA* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |