Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0862000_circ_g.5 |
ID in PlantcircBase | osa_circ_004923 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 37311506-37314221 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0862000 |
Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os01t086 2000-01) |
Parent gene strand | - |
Alternative splicing | Os01g0861900_circ_ag.1 Os01g0862000_circ_g.1 Os01g0862000_circ_g.2 Os01g0862000_circ_g.3 Os01g0862000_circ_g.4 Os01g0862000_circ_g.6 Os01g0862000_circ_g.7 Os01g0862000_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0862000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.109478415 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
37314144-37311576(+) 37311632-37314148(-) |
Potential amino acid sequence |
MSCGGLRPLIPADLPWFLKSTRTILHSIRIKHIYGSLKIKRPCHMFIVLF*(+) MINLGFSKSLSEWIGSNLKKDNEHVTWAFDLQAAIDMFNSYRVENGSRGFEEPREISGDQGPEA AA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |