Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0830100_circ_g.5 |
| ID in PlantcircBase | osa_circ_017361 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 35686719-35687788 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0830100 |
| Parent gene annotation |
Similar to Oligopeptidase A. (Os02t0830100-01);Similar to Oligop eptidase A. (Os02t0830100-02);Similar to predicted protein. (Os0 2t0830100-03);Similar to predicted protein. (Os02t0830100-04);Si milar to protease PrlC candidate1. (Os02t0830100-05) |
| Parent gene strand | - |
| Alternative splicing | Os02g0830100_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0830100-02:1 Os02t0830100-01:3 Os02t0830100-05:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.129360748 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35687722-35687391(+) |
| Potential amino acid sequence |
MALKAWYIGLLWPSLSWNLTLSGFDAAVCAAKPSAVAGNPSISFLSVINFSNFLVASSTFSLNF CVNFSSSCSI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |