Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0407000_circ_g.1 |
| ID in PlantcircBase | osa_circ_006770 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 13934004-13934299 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os10g0407000 |
| Parent gene annotation |
Pectin lyase fold/virulence factor domain containing protein. (O s10t0407000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0407000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.276473818 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13934233-13934028(+) |
| Potential amino acid sequence |
MKSSPSTIIVPHPNVPVPITLDDCQPRNLQL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |