Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G65670_circ_g.3 |
| ID in PlantcircBase | ath_circ_046004 |
| Alias | Ath_circ_FC0082, Ath_circ_FC5105, AT5G65670_C2 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 26255439-26255795 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
| Parent gene | AT5G65670 |
| Parent gene annotation |
Auxin-responsive protein IAA9 |
| Parent gene strand | + |
| Alternative splicing | AT5G65670_circ_g.1 AT5G65670_circ_g.2 AT5G65670_circ_g.4 |
| Support reads | 45 |
| Tissues | aerial, inflorescences, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G65670.2:2 AT5G65670.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.621048406 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26255474-26255792(+) |
| Potential amino acid sequence |
MLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLGQCGSNGA AGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLGQCG SNGAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGL GQCGSNGAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCD AIGL(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |