Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0183100_circ_g.6 |
| ID in PlantcircBase | osa_circ_023050 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 5664363-5664718 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os04g0183100 |
| Parent gene annotation |
7TM GPCR, rhodopsin-like domain containing protein. (Os04t018310 0-01);Similar to OSIGBa0140C02.4 protein. (Os04t0183100-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0183100_circ_g.5 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0183100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.188670365 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5664407-5664570(+) 5664704-5664661(-) |
| Potential amino acid sequence |
MLSLDLYPFNFILLTKKTRSSSSLPFETLPCTKKRSSISCQNLSSISTSDASASASITVQPIKS ECFFTILSSLFLRSPSSHKKGRWIFHVITGPVPVQFHIINKEDKVILFPPL*(+) MVKKHSDLIGWTVIDAEADASDVEMDDKFWHEILDLFFVHGRVSKGREEDDLVFFVNNMKLNGY RSSDNMENPPPFFVRRWAPKEQTAEYGEKTFRFDRLDSY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |