Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0309000_circ_g.1 |
| ID in PlantcircBase | osa_circ_009170 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 11786773-11791653 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os11g0309000 |
| Parent gene annotation |
Synaptojanin, N-terminal domain containing protein. (Os11t030900 0-01);Similar to predicted protein. (Os11t0309000-02);Synaptojan in, N-terminal domain containing protein. (Os11t0309000-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0309000-01:6 Os11t0309000-03:6 Os11t0309000-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.096105602 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11791624-11791642(-) |
| Potential amino acid sequence |
MEEQTGTVRTNCVDCLDRTNVTQSMIGRKILESQLQKISVLGDNNTISDYPAFDADYKVLWANH GDAISTQYSGTPALKGDFVRYGKRTTQGILNDLWNAMARYYLNNFADGTKQDAMDLLQGHHISS VSRDMPTPTKGLIENHASFRLAFALLLAAVIFLIMSLRRGTSF*(-) |
| Sponge-miRNAs | osa-miR5490 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |