Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0101000_circ_g.2 |
ID in PlantcircBase | osa_circ_035519 |
Alias | Os08circ00074 |
Organism | Oryza sativa |
Position | chr8: 65765-66102 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os08g0101000 |
Parent gene annotation |
ABI3/VP1 transcription factor family protein, Regulation of iron -deficiency response and tolerance (Os08t0101000-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | leaf and panicle/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0101000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007481* |
PMCS | 0.103057199 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
66095-66064(+) 65861-65996(-) 66060-66024(-) |
Potential amino acid sequence |
MQDSSTTVMALLRLRESTNCLRVKFNIAVSGFQFITALNHSRQNLWFLIFLGRYGSFYGRHVGA NIRCHGR*(+) MNWKPETAMLNFTLRQLVLSLSRSKAMTVVLLSCIQLRGRVFYFTVHGTEYLHPHASHRRTHIC QGR*(-) MAPNICTHMPPIEGPISAKEDKKPEILPRVVKSSDELETRNSNVEFHSETVGTLPESKQGHDSR ATVLHPATGSSLLLHRPWHRIFAPTCLP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |