Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0101000_circ_g.2 |
| ID in PlantcircBase | osa_circ_035519 |
| Alias | Os08circ00074 |
| Organism | Oryza sativa |
| Position | chr8: 65765-66102 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os08g0101000 |
| Parent gene annotation |
ABI3/VP1 transcription factor family protein, Regulation of iron -deficiency response and tolerance (Os08t0101000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | leaf and panicle/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0101000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007481* |
| PMCS | 0.103057199 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
66095-66064(+) 65861-65996(-) 66060-66024(-) |
| Potential amino acid sequence |
MQDSSTTVMALLRLRESTNCLRVKFNIAVSGFQFITALNHSRQNLWFLIFLGRYGSFYGRHVGA NIRCHGR*(+) MNWKPETAMLNFTLRQLVLSLSRSKAMTVVLLSCIQLRGRVFYFTVHGTEYLHPHASHRRTHIC QGR*(-) MAPNICTHMPPIEGPISAKEDKKPEILPRVVKSSDELETRNSNVEFHSETVGTLPESKQGHDSR ATVLHPATGSSLLLHRPWHRIFAPTCLP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |